Archives for December, 2008

Creationists and HIV Deniers, gawd bless em. So like, remember a while back when Andy Schlafly, Creationist of Conservapedia wrote PNAS demanding raw data, reagents, etc from Richard Lenski? And if Lenski refused to deliver that stuff to Schlafly (and his crack team of home schooled children) for ‘peer review’, then PNAS should retract the…

Wow! THANK YOU ‘Sports Illustrated’!

Jim Gorant, thank you. The dog approaches the outstretched hand. Her name is Sweet Jasmine, and she is 35 pounds of twitchy curiosity with a coat the color of fried chicken, a pink nose and brown eyes. She had spent a full 20 seconds studying this five-fingered offering before advancing. Now, as she moves forward,…

Book Binge

An unfortunate side effect of grad school is that I have had zero spare time for reading. I mean, sure Ive got several hours a day to read papers, but I mean fun reading. Well this past week I took a nice break from work/school/writing and I totally binged. Seven books in seven days. I…

What a crappy Christmas.

Maaaaaan. Christmas 2005: Intelligent Design gets taken off life support Christmas 2006: Mr. Dembskis Fartastic Flash Animation Christmas 2007: Discovery Institute gets caught breaking the eighth commandment. Christmas 2008: Boo. *sigh* Well, we can always count on little Casey Luskin for a good laugh.

Exasperating Ignorance

Oh George. I dont blame you for being angry. I attacked your profession, your profession is an extension of you, thus you took my comments personally, and completely missed what the hell I was talking about. 1– I dont know whether she had a bad experience with ‘The Wichita Beacon Journal’*… Someone who lives in…

Internet Cultural Literacy Moment

I grew up with the internet. This is my life. I regularly make internet culture references that others are too old/young to get (which is why I like hanging out with WoWers, even though I dont play– they get my jokes :P). So I thought I would do myself and my readers a favor by…

Rick Warren: HIV/AIDS Activist

UPDATE 1/9/09– More RIck Warrens anti-activism. When I found out yesterday that Rick Warren was speaking at Obamas inauguration, I was pretty grossed out. Grossed out, and confused. Obama and Warren appear to be polar opposites… but whatever. Its Obamas party, he can invite whoever he wants. I didnt care. Until I read how Obama…

Lentiviruses: Me, and you, and Zaboomafoo

Ive been *patiently* waiting two damn weeks for this paper to come out: A transitional endogenous lentivirus from the genome of a basal primate and implications for lentivirus evolution. Gifford and Katzourakis are the same folks who found RELIK a while back– a lentiviral ERV in a species of European rabbit. This time, after screening…

ew… epigenetics in SEED…

*sigh* My swooning over Venter on the cover of the latest edition of SEED was rudely interrupted by Larry Moran. Evidently he really does get SEED ‘for the articles’. heh. Epigenetics at SEED Yeah, um, this SEED article… this article is not helpful. For you, or me, or the scientific literacy we are fighting for.…

A Beautiful Mind

Ive spent the past week staring at a computer screen, comparing amino acid sequences of the envelope gene of various kinds of HIV-1. CNNKTFNGTGPCHNVSTVQCTHGIKPVVSTQLLLNGSLAEREIIIRSENLTDNVKTIIVHLNESVEISCTR PNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISENWNKTLEWVRKKLEEHFPNKTIAFKPSSGGDLEI TTHSFNCRGEFFYCNTSKLFNGTDN CNNKTFNRTGPCNNVSTVQCTHRIKPVVSTQLLLNGSLAERKIIIRSKNLTDNVKTIIVHLNESVKIECTR PNNNTRQSTKIRPGQVFYAISNIIGDIRQAHCTINKKEWNTTLQQVTEKLKEHFPNKTIAFQPSSGEDLEI TTHSFNCKREFFYCNTSKLFNSTDN CNNKTFNRTGPCNNVSTVQCTHRIKPVVSTQLLLNGSLAERKIIIRSENLTDNVKTIIVHLNESVEINCTR PNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISKENWNKTLQWVKEKLEEHFPNKTIVFKPSSGGDLEI TTHSFNCRGEFFYCNTSKLFNSTDN CNNKTFNRTGPC… Im just looking for changes and patterns (hey that glycosylation site disappeared! oh, all the sequences that dont process gp160–>gp120/gp41 lack that…