Humor

Category archives for Humor

*GAG* GAAAAAAAAAAAAAAAK!!

Continuing this weeks theme of spewing– Drove home to visit the parents for a few days (dial-up country w00t!– expect spammed comments to stay spammed for a while, sry). While Im sure you all are under the impression Im high-society and enjoy luxury, there are few things that make me happier than a bag of…

Star Wipe. 3:38. Not joking.

Star Wipe Lisa: OK, I finished editing the gardening sequence. . . Homer: OK, from here we star wipe to a glamour shot of Flanders paying his bills, then we star wipe to Flanders brushing his teeth. . . Lisa: Dad, there are other wipes besides star wipes. . . Homer: Why eat hamburger when…

Side Note:

When the hell did Behe turn into Crazy Mr. Burns?!? Jesus Christ!

First Birmingham. Then… THE WORLD!!!

BWAHAHAHAHAHAHA!!! England’s second-largest city has decided to drop apostrophes from all its street signs, saying they’re confusing and old-fashioned. Soon Ill control everything… My wish is your command! BWAAAAAAAHAHAHAHAHA!!! In her best-selling book “Eats, Shoots and Leaves,” Lynne Truss recorded her fury at the title of the Hugh Grant-Sandra Bullock comedy “Two Weeks Notice,” insisting…

What a crappy Christmas.

Maaaaaan. Christmas 2005: Intelligent Design gets taken off life support Christmas 2006: Mr. Dembskis Fartastic Flash Animation Christmas 2007: Discovery Institute gets caught breaking the eighth commandment. Christmas 2008: Boo. *sigh* Well, we can always count on little Casey Luskin for a good laugh.

Internet Cultural Literacy Moment

I grew up with the internet. This is my life. I regularly make internet culture references that others are too old/young to get (which is why I like hanging out with WoWers, even though I dont play– they get my jokes :P). So I thought I would do myself and my readers a favor by…

A Beautiful Mind

Ive spent the past week staring at a computer screen, comparing amino acid sequences of the envelope gene of various kinds of HIV-1. CNNKTFNGTGPCHNVSTVQCTHGIKPVVSTQLLLNGSLAEREIIIRSENLTDNVKTIIVHLNESVEISCTR PNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISENWNKTLEWVRKKLEEHFPNKTIAFKPSSGGDLEI TTHSFNCRGEFFYCNTSKLFNGTDN CNNKTFNRTGPCNNVSTVQCTHRIKPVVSTQLLLNGSLAERKIIIRSKNLTDNVKTIIVHLNESVKIECTR PNNNTRQSTKIRPGQVFYAISNIIGDIRQAHCTINKKEWNTTLQQVTEKLKEHFPNKTIAFQPSSGEDLEI TTHSFNCKREFFYCNTSKLFNSTDN CNNKTFNRTGPCNNVSTVQCTHRIKPVVSTQLLLNGSLAERKIIIRSENLTDNVKTIIVHLNESVEINCTR PNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISKENWNKTLQWVKEKLEEHFPNKTIVFKPSSGGDLEI TTHSFNCRGEFFYCNTSKLFNSTDN CNNKTFNRTGPC… Im just looking for changes and patterns (hey that glycosylation site disappeared! oh, all the sequences that dont process gp160–>gp120/gp41 lack that…

I survived yesterday Back to normal science programming soon. But for all of you working to ween yourself off of politics news, Ive got a nicotine patch for ya: Freepers and RR. Bask in the schadenfreude. Come down off the laughing gas. Get back to work OH! And Im sure you all know what my…

Cocksuckers of the World Unite

A friend of a friend is a comedian/singer in NYC, Ben Lerman. Ben hatched a nefarious plot to stop Proposition Hate– To quote Margaret Cho, “Behind every gay man is a steadfast and supportive fag hag” (show of hands, who took a gay boy to prom in high school?). To capitalize on this historical bond,…

EXPELLED: The punchlines wont stop coming

YAAAAAY!!! The EXPELLED DVD is coming out soon!! EXPELLED! Starring, BEN STEIN! Featuring, BEN STEIN! “FOUR STARS! I Love This Film!”– BEN STEIN! heeeeeeeehehehehe! BEN STEIN!!!! **JAZZHANDS** Well, I encourage you all to go to EXPELLEDs website to vote in their poll: “Do you think Darwin’s theories are OUTDATED? Yes, No, Maybe” For real! Go…