Humor

Category archives for Humor

*GAG* GAAAAAAAAAAAAAAAK!!

Continuing this weeks theme of spewing– Drove home to visit the parents for a few days (dial-up country w00t!– expect spammed comments to stay spammed for a while, sry). While Im sure you all are under the impression Im high-society and enjoy luxury, there are few things that make me happier than a bag of…

Star Wipe. 3:38. Not joking.

Star Wipe Lisa: OK, I finished editing the gardening sequence. . . Homer: OK, from here we star wipe to a glamour shot of Flanders paying his bills, then we star wipe to Flanders brushing his teeth. . . Lisa: Dad, there are other wipes besides star wipes. . . Homer: Why eat hamburger when…

Side Note:

When the hell did Behe turn into Crazy Mr. Burns?!? Jesus Christ!

First Birmingham. Then… THE WORLD!!!

BWAHAHAHAHAHAHA!!! England’s second-largest city has decided to drop apostrophes from all its street signs, saying they’re confusing and old-fashioned. Soon Ill control everything… My wish is your command! BWAAAAAAAHAHAHAHAHA!!! In her best-selling book “Eats, Shoots and Leaves,” Lynne Truss recorded her fury at the title of the Hugh Grant-Sandra Bullock comedy “Two Weeks Notice,” insisting…

What a crappy Christmas.

Maaaaaan. Christmas 2005: Intelligent Design gets taken off life support Christmas 2006: Mr. Dembskis Fartastic Flash Animation Christmas 2007: Discovery Institute gets caught breaking the eighth commandment. Christmas 2008: Boo. *sigh* Well, we can always count on little Casey Luskin for a good laugh.

Internet Cultural Literacy Moment

I grew up with the internet. This is my life. I regularly make internet culture references that others are too old/young to get (which is why I like hanging out with WoWers, even though I dont play– they get my jokes :P). So I thought I would do myself and my readers a favor by…

A Beautiful Mind

Ive spent the past week staring at a computer screen, comparing amino acid sequences of the envelope gene of various kinds of HIV-1. CNNKTFNGTGPCHNVSTVQCTHGIKPVVSTQLLLNGSLAEREIIIRSENLTDNVKTIIVHLNESVEISCTR PNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISENWNKTLEWVRKKLEEHFPNKTIAFKPSSGGDLEI TTHSFNCRGEFFYCNTSKLFNGTDN CNNKTFNRTGPCNNVSTVQCTHRIKPVVSTQLLLNGSLAERKIIIRSKNLTDNVKTIIVHLNESVKIECTR PNNNTRQSTKIRPGQVFYAISNIIGDIRQAHCTINKKEWNTTLQQVTEKLKEHFPNKTIAFQPSSGEDLEI TTHSFNCKREFFYCNTSKLFNSTDN CNNKTFNRTGPCNNVSTVQCTHRIKPVVSTQLLLNGSLAERKIIIRSENLTDNVKTIIVHLNESVEINCTR PNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISKENWNKTLQWVKEKLEEHFPNKTIVFKPSSGGDLEI TTHSFNCRGEFFYCNTSKLFNSTDN CNNKTFNRTGPC… Im just looking for changes and patterns (hey that glycosylation site disappeared! oh, all the sequences that dont process gp160–>gp120/gp41 lack that…

I survived yesterday Back to normal science programming soon. But for all of you working to ween yourself off of politics news, Ive got a nicotine patch for ya: Freepers and RR. Bask in the schadenfreude. Come down off the laughing gas. Get back to work ? OH! And Im sure you all know what…

Cocksuckers of the World Unite

A friend of a friend is a comedian/singer in NYC, Ben Lerman. Ben hatched a nefarious plot to stop Proposition Hate— To quote Margaret Cho, “Behind every gay man is a steadfast and supportive fag hag” (show of hands, who took a gay boy to prom in high school?). To capitalize on this historical bond,…

EXPELLED: The punchlines wont stop coming

YAAAAAY!!! The EXPELLED DVD is coming out soon!! EXPELLED! Starring, BEN STEIN! Featuring, BEN STEIN! “FOUR STARS! I Love This Film!”– BEN STEIN! heeeeeeeehehehehe! BEN STEIN!!!! **JAZZHANDS** Well, I encourage you all to go to EXPELLEDs website to vote in their poll: “Do you think Darwin’s theories are OUTDATED? Yes, No, Maybe” For real! Go…