Protein modeling and the Siamese cat

"By night all cats are gray"  - Miguel Cervantes in Don Quixote

 

I've always liked Siamese cats.   Students do, too.  "Why Siamese cats wear masks" is always a favorite story in genetics class.  So, when I opened my January copy of The Science Teacher, I was thrilled to see an article on Siamese cat colors and proteins AND molecular genetics (1).

In the article, the authors (Todd and Kenyon) provide some background information on the enzymatic activity of tyrosinase and compare it to the catechol oxidase that causes fruit to brown, especially apples.  Tyrosinase catalyzes the first step of a biochemical pathway where tyrosine is converted to dopaquinone and then to the dark colored substance, melanin.  Melanin is responsible for the brown color in the ears, paws, tail, and face of Siamese cats.

Melanin in Molecule World Melanin in Molecule World

 

 

 

 

 

 

 

 

 

 

 

The fun part of the story is that some versions of the tyrosinase gene have a mutation that makes this enzyme less stable at warmer temperatures.  In warmer areas of the cat's body, less melanin is produced, giving the cat a lighter colored body.

I love the story of the coat coloring  and I think this activity has the potential to interest students.

I also like the approach that the authors take with discussing proteins and the associated phenotypes first before getting into DNA and the central dogma.  I use this same order in my bioinformatics class.

There are, however, a few things that I would change with this activity.

Too many hydroxyl groups

First, the article and the teacher guide have the structure of tyrosine wrong.  Tyrosine only has one hydroxyl group attached to the six-carbon ring, as shown below, not two hydroxyl groups as shown in the article and the teachers' guide.

Tyrosinase reaction from Teachers' Guide. The extra hydroxyl group is marked. Tyrosinase reaction from Teachers' Guide. The extra hydroxyl group is marked.

 

 

 

 

 

 

 

Space-filling models of Tyrosine and Dopaquinone downloaded from the NCBI's PubChem database are shown below.

Tyrosine and dopaquinone Tyrosine and dopaquinone

 

 

 

 

 

 

 

Too many proteins in too short a time

Second, I think the authors include way too many different protein stories and different explanations for why a protein might be inactivated.  Todd and Kenyon have done quite a bit of work creating activities with several different proteins. But I think the plan to have students cover all eight proteins in six days would be too confusing for many students.  The activity has students read about or work with:  lactase, cellulase, tyrosinase, catechol oxidase, proteases, kinesin, galactosyl transferase, and tyrosine kinase, not to mention Gleevec and the way it interacts with the BCR-ABL fusion protein.  I teach a college bioinformatics course and even the best of my students would get confused by looking at eight different proteins without some kind of common thread.  The take home lesson that denaturation negatively impacts tyrosinase activity is easy to lose among all the unrelated activities.

Where are the 3D models?

When I read the description of the article, I thought it might include activities where students looked at 3D protein models to see how they changed when they were denatured by heat or pH. Instead, they just watch a short video. A better approach, I think, would be to have students work first-hand with structure models and see the change for themselves.  Or maybe fry and egg.  The effects of protein denaturation are pretty clear when you watch an egg cook.

This is my bias, but I think an active learning approach, where students actually look at 3D protein and chemical models and identify chemical interactions, would be better in long run and better equip students for future learning. I think the common practice of hiding the biochemistry makes genetics much harder to understand and far less straightforward than it should be.

And, as it turns out there are 3D models of tyrosinase that students could use.  They're from Bacillus megatherium, but that's how biology works.  If an enzyme activity is beneficial, evolutionary processes tend to keep it around.

Using 3D Models to look at albino cats

No models exist from the Siamese cat protein with the brown ear point mutation, but it is possible to make 3D protein models that show the affect of a different mutation, in tyrosinase, that leads to albino cats. This mutation occurs when a cytosine is deleted at nucleotide 975, creating a frameshift (2).  To simulate the mutation's effect, we can hide the amino acids that would be lost.  This model isn't perfect because the shorter protein might fold somewhat differently, but this does provide a satisfying explanation for an inactive enzyme.

Here's what to do:

  1. Open Molecule World on the iPad (*).
  2. Download 4P6R.
  3. Color the protein chains by molecule.
  4. Open the sequence viewer and touch the name of the last row to select it.  This row contains tyrosine, the substrate for the enzyme, and for each chain, two atoms of zinc.
  5. Change the coloring style to element.

Now, you can see the substrate bound in the active site.  Notice this protein has two identical subunits.  Each one is bound to tyrosine and zinc.

Tyrosinase with tyrosine and zinc in the active site. Tyrosinase with tyrosine and zinc in the active site.

 

 

 

 

 

 

 

 

 

 

You may want to change the atom visibility to show all the atoms or just the core backbone, like I have here, to see how the tyrosine is positioned.

*Many of the things I describe here can be done in Cn3D, but it's a bit more complicated.

 

Modeling the mutation's affect

This next part is a little more complicated because I had to split the protein sequence into three parts to avoid introducing spaces.

    1. Carry out the following process in three steps. First, copy the sequence below.KYRVRKNVLHLTDTEKRDFVRTVLIKEKGIYDRYIAWHGAAGKFHTPPGSDRNA

 

    1. Touch the Selection button and paste the sequence below in the Select pattern window.
    2. Start the search.  The pasted sequence will be highlighted in the protein sequence.
    3. Copy the next part of the sequence (below).  Touch the Selection button again and search for this pattern as before.
      AHMSSAFLPWHREYLLRFERDQSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGN

 

    1. Copy the next part of the sequence (below).  Touch the Selection button again and search for this pattern as before.
      GNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKAPTLPTRDDVL

 

  1. When you're done highlighting sequences, you'll see each subunit has a region that appears brighter and a region in the center that appears more dim. The bright colored residues are incorporated into the protein before ribosomes encounter the frame shift mutation and a stop codon shortly afterwards. This portion of the protein can be produced in the albino cat.
  2. Look at the dim areas of each subunit.  These amino acids would be lost when the frameshift mutation is present.  Notice where the tyrosine is located.
Residues that would be lost because of the frameshift mutant are shown in gray. Residues that would be lost because of the frameshift mutant are shown in gray.

 

 

 

 

 

 

 

 

 

 

 

8.  To make the mutations affect on the protein even more clear, open the Show/Hide button and choose "Hide unselected."  The amino acid residues that would be lost because of the mutation disappear.

Residues that would be lost because of the frame shift mutation are hidden. Residues that would be lost because of the frame shift mutation are hidden.

 

 

 

 

 

 

 

 

 

 

Now, it's really clear.  If the residues that bind tyrosine and modify it's structure are gone, the enzyme is unable to function.  If we don't have tyrosinase working to help make melanin, we get white cats.

 

References:

  1. Amber Todd and Lisa Kenyon, How do Siamese cats get their color? The Science Teacher. 2016;83(1):29-36
  2. Imes D, Geary L, Grahn R, Lyons L. Albinism in the domestic cat (Felis catus) is associated with a tyrosinase (TYR) mutation. Animal Genetics. 2006;37(2):175-178. doi:10.1111/j.1365-2052.2005.01409.x.

More like this

On pinene and inhibiting enzymes. People of a certain age may remember a series of really funny commercials featuring Euell Gibbons and his famous question about whether you've ever eaten a pine tree.  "Some parts are edible" said Euell. Perhaps some parts are, but other pine tree products aren't…
Want to learn more about Parkinson's disease? See why a single nucleotide mutation messes up the function of a protein? I have a short activity that uses Cn3D (a molecular viewing program from the NCBI) to look at a protein that seems to be involved in a rare form of Parkinson's disease and I…
Imagine a simple hike in a grassy part of South America.  You hear a rattle and feel a quick stab of pain as fangs sink into your leg.  Toxins in the snake venom travel through your blood vessels and penetrate your skin.  If the snake is a South American rattlesnake, Crotalus terrific duressis, one…
In my last post, I wrote about insulin and interesting features of the insulin structure.  Some of the things I learned were really surprising.  For example, I was surprised to learn how similar pig and human insulin are.  I hadn't considered this before, but this made me wonder about the human…