Prosecuting faked HIV vaccine results

Remember this?

Wait, what? Faked HIV vaccine results

The researcher accused of manipulating his reagents to 'show his HIV vaccine strategy worked' admitted he did it:

Investigators say former Iowa State University laboratory manager Dong-Pyou Han has confessed to spiking samples of rabbit blood with human antibodies to make an experimental HIV vaccine appear to have great promise.

And the government is prosecuting him for it:

Responding to a major case of research misconduct, federal prosecutors have taken the rare step of filing charges against a scientist after he admitted falsifying data that led to millions in grants and hopes of a breakthrough in AIDS vaccine research.

Well, I mean, thats nice. I support this, 100%.

BUT.

The NIH rarely, *rarely*, pursues criminal charges for fraudulent work.

So why this guy? Why now?

I have no idea who Dong-Pyou Han is. Its not like it was a Big Name in HIV vaccine research making things up. Han is no Beatrice Hahn or Peter Kwong. Sure he wanted to be a Big Dog, and was willing to cheat to get there, but its not like his work was a massive influence on the field.

Im actually having difficulty finding much at all from the guy, other than his miraculous/fake findings. A handful of middle-author papers.

So why, *exactly* are they prosecuting this guy?

Why not all these people?

Why not the people responsible for this?

I am all for prosecuting scientific misconduct. But this seems like an empty, arbitrary gesture. *shrug*

 

More like this

This happened over the holidays, and I totally missed it: ISU researcher quits amid allegations of AIDS-research fraud involving millions of federal dollars Han apparently added human blood components to the rabbit blood to skew the results. The human blood came from people whose bodies had…
Predatory open access journals seem to be a hot topic these days. In fact, there seems to be kind of a moral panic surrounding them. I would like to counter the admittedly shocking and scary stories around that moral panic by pointing out that perhaps we shouldn't be worrying so much about a fairly…
Ive spent the past week staring at a computer screen, comparing amino acid sequences of the envelope gene of various kinds of HIV-1. CNNKTFNGTGPCHNVSTVQCTHGIKPVVSTQLLLNGSLAEREIIIRSENLTDNVKTIIVHLNESVEISCTR PNNNTRKSIRIGPGQAFYATGDIIGDIRQAHCNISENWNKTLEWVRKKLEEHFPNKTIAFKPSSGGDLEI…
The strangest things have happened in the past 24 hours. 1-- New FDA approved clinical trial of anti-HIV vaccine YAY, right? Except I have no idea what the hell they are proposing to do in this clinical trial, other than what was mentioned in press releases-- Its some kind of killed virus. Why…

So why, *exactly* are they prosecuting this guy?

It's a good chunk of change. The criminal complaint is here, the indictment here (PDFs).

While probably an unpopular opinion.... And i do not 100% agree with it... from my understanding

They are not prosecuting the XMRV cluster FU** because it is going to alienate an already alienated group of people. Some of those people have symptoms consistent with an infectious disease. Others have mental health issues. Regardless, It will only serve to create more miss-trust in science. The government also cannot just yank funding from labs that wrote grants to detect XMRV etc. They took on students, techs, and postdocs on the assumption the grant was funded. I know at least one honest postdoc who wasted 1-2 years of his life developing real assays to detect XMRV. The powers at work have decided that it is cheaper and easier to let the entire incident go and move on.

That being said, I think they should investigate all cases of fraud and persecute all those responsible

By other kevin (not verified) on 26 Jun 2014 #permalink